PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 28580
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
Family GATA
Protein Properties Length: 417aa    MW: 45938.7 Da    PI: 10.7535
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
28580genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA37.14.3e-12337370134
   GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
            C+nC++ +T++WR   +g   LCnaCGl+ rk+ 
  28580 337 CRNCRAMETKQWRLPVEGAGVLCNACGLRDRKQA 370
            *************999**************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.0032109157IPR001005SANT/Myb domain
SuperFamilySSF466894.96E-6112155IPR009057Homeodomain-like
SuperFamilySSF577162.04E-10329377No hitNo description
Gene3DG3DSA:3.30.50.102.2E-10331377IPR013088Zinc finger, NHR/GATA-type
SMARTSM004011.7E-8331382IPR000679Zinc finger, GATA-type
CDDcd002026.38E-7336368No hitNo description
PfamPF003208.8E-10337371IPR000679Zinc finger, GATA-type
PROSITE patternPS003440337362IPR000679Zinc finger, GATA-type
PROSITE profilePS501149.763337367IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MSEREKRLAG RVAWPRANGT RAKAKARTRA SATKGEGSSG AARANGERAA KTDAVKDAEE  60
DVSNNRPGER GFTDEEIAAS RAALEEELRR GGADEDSLLG LRTIGAAGAR EGWDDEEVAA  120
FAEHATRYGD DLFRLRAKLP KKSMRDVVNY YYNVWQVGFA NYGRVDVEGA EEPAPRERAR  180
RGPAPKYTVE QVRREKDEKS LRGFVDWIRG VAINTKRAML NVHRAPTTAR VKGHMMTRWR  240
TVTRSEDADD GVAREAYLKD LKRRMTAARF TKEEQEAAAR MKTKAKSSKA SSAKVTKTAS  300
SGDAATKTKK TASAPADGAP TPKKRKRRID DGQPKICRNC RAMETKQWRL PVEGAGVLCN  360
ACGLRDRKQA KKNEASAAGE TEPTPKENKT PDRGKDGLKK KRSPGLKPTP DRNFQL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1321327PKKRKRR
2322327KKRKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0005990.0CP000599.1 Ostreococcus lucimarinus CCE9901 chromosome 19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001422393.10.0predicted protein
TrEMBLA4SAI30.0A4SAI3_
STRINGA4SAI30.0(Ostreococcus lucimarinus CCE9901)